Olá amigos!

De tempos em tempos acontece de eu receber dúvidas e emails ligados ao mesmo tema. Nestes últimos dias tenho recebido perguntas que se referem a ofensas, xingamentos e críticas. Em resumo, como lidar com pessoas que são difíceis de conviver por sempre apresentar este tipo de comportamento?

Bem, evidentemente não existe uma resposta única para esta pergunta. Isto porque podemos até aprender a lidar melhor, de modo a não nos afetarmos (ou pelo menos não nos afetarmos tanto), mas, também não devemos ser ingênuos e aceitar passivamente. Em outras palavras, às vezes deixar de conviver – se possível – acaba sendo a estratégia mais adequada.

Palavras como sons vazios

Na filosofia existe a ideia de que as palavras seriam flatus vocis, vozes vazias, sons vazios. Se alguém te chama de um nome ofensivo ela está usando uma palavra para ofender. Como conhecemos português e, portanto, como o sentido atribuído àquele som foi aprendido, podemos nos ofender.

Agora, se alguém diz – Donaudampfschifffahrtsgesellschaftskapitaenswitwe – e você não sabe alemão, você se ofenderia? Provavelmente não, porque você não saberia o sentido daquela palavra e entender que a linguagem com seus sons é, em última instância, sons sem sentido nos ajuda a criar distanciamento.

Assim como uma palavra estrangeira não vai trazer nenhum sentimento negativo, uma palavra em português pode também ter o mesmo efeito. Porque uma palavra depreciativa ou agressiva, ao contrário do que dizem, não é como dar um soco, um murro, uma facada, um tiro.

Porque nestes casos há uma agressão do contato, enquanto que nas palavras existe uma relação muito mais subjetiva. Como aprendemos em redação, em uma comunicação temos o emissor e o receptor. E, embora o emissor tenho o poder de dizer isto ou aquilo, há um meio (que é a língua, no nosso caso, o português) e do outro lado há o receptor, quem está recebendo a mensagem ou para quem ela está sendo dirigida (o destinatário em um email ou carta, o ouvinte em uma fala, etc).

O X da questão é que não podemos – como ouvintes, como receptores – controlar o comportamento do emissor. Se eu estou ouvindo, não tem como eu querer que a pessoa fale do jeito que eu quero que ela fale. Se pararmos para pensar, veremos que é quase que uma loucura querer que a pessoa fale conforme nós falamos.

E, se embora não possamos controlar o que é dito, podemos sim controlar o modo como a mensagem é captada e recebida. Por exemplo, se eu peço uma informação quando estou em uma cidade desconhecida e a pessoa não me responde ou me responde sem nenhuma educação, o problema é dela. Eu não posso controlar o comportamento verbal dela.

Porém, a forma como eu vou reagir está sob o meu controle. Apesar de que reagimos quase que instantaneamente, existe um espaço de tempo – sempre existe! – para decidir se vamos agir também com grosseria, se vamos silenciar ou se vamos embora ou dar um abraço. Enfim, o que está sob o nosso controle é a forma como reagimos.

Quando alguém diz que uma ofensa é como uma facada, ela está dizendo uma metáfora. Como vimos, a fala é tão somente a emissão de um som por um aparelho fonador. Porém, como é impossível não entender uma língua depois que você a aprendeu, o som se transforma em sentido e o sentido é vivenciado como uma sensação corporal. E a sensação corporal, por sua vez, é sentida como agradável ou desagradável. No fim, quando reagimos, não estamos mais reagindo ao som mas sim à sensação corporal que é acima de tudo uma sensação temporária.

Alguém diz: “Você é burro” (um som)

Este som é ouvido. Se houvesse um ruído muito alto não seria e o processo seria interrompido. Mas se é ouvido, o som se transforma em uma informação mental. Burro. Burrice. Isto é uma ofensa. E, em questão de segundos, esta informação é vivenciada diretamente em sensação físicas: palpitação ou taquicardia ou náusea ou irritação ou desconforto aqui ou ali.

Segundos depois, a sensação é etiquetada como uma sensação desagradável. E, muito rapidamente, há a opção instintiva de lutar ou fugir. Lutar significa brigar, gritar, responder, querer agredir… e fugir significa correr, sair dali, passar mal e desmaiar, etc…

Som, sentido, sensação… tudo isso é muito transitório. Como surge em um momento, no momento seguinte não existe mais. Entretanto, como é típico, as pessoas tendem a reviver suas experiências. E se alguém disse “você é burro” e este dizer durou três segundos e acabou, quem ouviu consegue levar – se quiser ou sem perceber – estes três segundos como uma gravação a ser repetida centenas e centenas de vezes. E para quê?

O que foi dito, já foi dito. E é um problema e uma responsabilidade de quem disse. Não podemos controlar o dizer alheio. Mas podemos entender o processo como um todo e compreender que temos o poder de responder de um jeito ou de outro.

É como um apelido. Em uma sala de aula, um grupinho inventa um apelido para o gordinho da sala: baleia, Free Willy, bola. Se o gordinho não liga, o apelido não pega. Mas basta ficar irritado que o apelido cola por anos…talvez até pela vida toda…

Claro que em um mundo ideal as pessoas seriam mais amorosas e não fariam este tipo de brincadeira caso soubessem como isto marca. Porém, cada um de nós também tem o poder de aprender a reagir e a reagir melhor às palavras que ouvimos.

Ou seja, é necessário aprender que o poder da comunicação não está no emissor e sim no receptor. É na recepção que o sentido será sentido e vivenciado. Se não fosse assim, seríamos meros robôs a reagir conforme um comando externo.

Mas sei que é um longo processo para passar a entender de verdade o que aqui foi dito. Podemos aprender com uma série de técnicas que vão da meditação à psicoterapia ou análise. A vantagem é que somos testados com uma frequência que não gostaríamos e, portanto, temos bastante chance para aprender que as palavras são sons e que reagimos às sensações corporais. Entre o som, entre o sentido, entre a sensação e entre a reação existem espaços de escolha.

Conclusão

 Tudo isso não significa ter passividade e aceitar tudo. Em alguns casos é preciso tomar medidas judiciais por dano moral, calúnia, difamação. Mas no dia a dia, nas relações com conhecidos, familiares ou amigos, temos muitas chances de reagir com mais amorosidade ao sofrimento do outro. Afinal, ninguém ofenderia, xingaria ou gritaria se não estivesse sofrendo.

Psicólogo Clínico e Online (CRP 06/145929), formado há 14 anos, Mestre (UFSJ) e Doutor (UFJF), Instrutor de Mindfulness, Coach e Presidente do Instituto Felipe de Souza. Como Professor no site Psicologia MSN venho ministrando dezenas de Cursos de Psicologia, através de textos e Vídeos em HD. Faça como centenas de alunos e aprenda psicologia através de Cursos em Vídeo e Ebooks! Loja de Vídeos e Ebooks. Você pode também agendar uma Sessão Online via Skype, Terapia Cognitivo Comportamental, Problemas de Relacionamentos, Orientação Profissional e Coaching de Carreira , fazer o Programa de 8 Semanas de Mindfulness Online. E não se esqueça de se inscrever em nosso Canal no Youtube! e Instagram! Email - [email protected] - Agendar - Whatsapp (11) 9 8415-6913